PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10001295m
Common NameEUTSA_v10001295mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 936aa    MW: 104266 Da    PI: 5.8027
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10001295mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.31.9e-42144221178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +Cqve+Ceadls++k+yhrrhkvCe+hska++++v g++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  Thhalv10001295m 144 ACQVENCEADLSKVKDYHRRHKVCEMHSKATSAIVGGIMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNP 221
                      5**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-34138206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.633142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-39144223IPR004333Transcription factor, SBP-box
PfamPF031107.4E-31145218IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.58E-8725826IPR020683Ankyrin repeat-containing domain
CDDcd002042.47E-9727823No hitNo description
Gene3DG3DSA:1.25.40.206.4E-8727824IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 936 aa     Download sequence    Send to blast
MEARIEGEAQ HLYGLRAMDL RSVGKRSVEW DLNDWKWDGD LFVATQLNPG GGETMGRQFF  60
PIGNSSNSSS SCSDEGNNTE LTVTRPREVE KKRRAVATGE DNNGGGGGGL TLKLGDDGYD  120
LNGEREGGSA AKKTKFGGGT NRAACQVENC EADLSKVKDY HRRHKVCEMH SKATSAIVGG  180
IMQRFCQQCS RFHVLQEFDE GKRSCRRRLA GHNKRRRKTN PEPGANGNPL SDDHQSSNFL  240
LISLLKILSN MHSNRSDHPG DQDLMSHLLK SLVSHAGEQL GKNLVELLLQ GGSQASLNIG  300
NSNLLAIEQA PQEDLKQAPE IPRQELYANG TATENRSEKQ VKVNDFDLND IYIDSDDGTD  360
IERSPPPTNP ATSSLDYPSW IHQSSPPQTS RNSDSASDQS PSSSSEDAQM RTGRIVFKLF  420
GKEPNDFPVV LRGQILDWLS HSPTDMESYI RPGCIVLTIY LRQAETAWED LSDDLGFSLR  480
KLLDLSDDPL WTTGWIYVRV QNQLAFVFDG QVVVDTSLPL RSRDYSHIMS VRPLAVATTG  540
KAQFTVKGIN LRRPGTRLLC AVEGKYLIQE TKHDSTKEND DCNENNEIVE CVSFSCDLPI  600
TSGRGFMEIE DQGLSSSFFP FIVVEEDDVC SEIRILETTL EFTETDSAKQ AMDFIHEIGW  660
LLHRSKLGES DPNPDVFPLE RFKWLIEFSM DREWCAVIRK LLNMFFEGAV GDSSSSSDAA  720
LSELCLLHRA VRKNSKPMVE MLLRYVPKQQ RHSLFRPDAT GPAGLTPLHI AAGKDCSEDV  780
LDALTEDPAM VGIKAWKTSR DSTGFTPEDY ARLRGHFSYI HLIQRKINKK STTEDHVVVN  840
IPVSFSDREM KESKSGPVAS ALEITTQTNQ LQCKLCDHKL VYGTARRSVA YRPAMLSMVA  900
IAAVCVCVAL LFKSCPEVLY VFQPFRWELL DYGTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-321452181184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBMTransfer from AT2G47070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8159480.0KC815948.1 Arabis alpina SQUAMOSA promoter binding protein-like protein 1 (SPL1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397898.10.0hypothetical protein EUTSA_v10001295mg
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLV4N2D60.0V4N2D6_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.4__2943__AT2G47070.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30302764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1